Anti-TCTA antibody
| Name | Anti-TCTA antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98063 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 53-102 ( IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR ) of Human TCTA (NP_071503) |
| Description | Rabbit Polyclonal |
| Gene | TCTA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TCTA antibody (ab98063) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal stomach lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution