Anti-TEKT4 antibody
| Name | Anti-TEKT4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83818 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Cat, Pig |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 36-85 ( TSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQ ) of Human TEKT4 (NP_653306) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | TEKT4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TEKT4 antibody (ab83818) at 1 µg/ml (in 5% skim milk / PBS buffer) + HeLa cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution