Anti-TGF beta 3 antibody
| Name | Anti-TGF beta 3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90264 |
| Prices | $376.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 324 - 373 ( FRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEAS ) of Human TGF beta 3 (NP_003230) |
| Description | Rabbit Polyclonal |
| Gene | TGFB3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TGF beta 3 antibody (ab90264) at 1 µg/ml + SH-SYSY cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution