LY6G5B Antibody

• Supplier: Genway Biotech
• Catalog: GWB-MW574G
• Prices: $368.00
• Sizes: 50 µg
• Host: Rabbit
• Applications: WB
• Species Reactivities: Horse, Human, Pig
• Antigen: Synthetic Peptide within the following region: IYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSS
• Purity/Format: Lyophilized powder. Add 50 ul of distilled water. Final anti-LY6G5B antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
• Description: Rabbit
• Gene: LY6G5B