MGC34821 Antibody

• Supplier: Genway Biotech
• Catalog: GWB-MU126I
• Prices: $368.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic Peptide within the following region: VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF
• Purity/Format: Lyophilized powder. Add 50 ul of distilled water. Final anti-MGC34821 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
• Description: Rabbit Polyclonal
• Gene: SLC22A24