4732471D19Rik Antibody

• Supplier: Genway Biotech
• Catalog: GWB-MU067D
• Prices: $368.00
• Sizes: 50 µg
• Host: Rabbit
• Applications: WB
• Species Reactivities: Mouse
• Antigen: Synthetic Peptide within the following region: STSLLKCQSDKTQWQTWDELVEHLQFLLSSYQHVLREHLRSSVIDRKDLI
• Purity/Format: Lyophilized powder. Add 50 ul of distilled water. Final anti-4732471D19Rik antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
• Description: Rabbit
• Gene: Simc1