| Name | C10orf96 Antibody |
|---|---|
| Supplier | Genway Biotech |
| Catalog | GWB-MU054I |
| Prices | $368.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Guinea Pig, Pig, Rabbit |
| Antigen | Synthetic Peptide within the following region: QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKE |
| Purity/Format | Lyophilized powder. Add 50 ul of distilled water. Final anti-C10orf96 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. |
| Description | Rabbit Polyclonal |
| Gene | CCDC172 |
| Supplier Page | Shop |