Name | TMCO4 Antibody |
---|---|
Supplier | Genway Biotech |
Catalog | GWB-MU009I |
Prices | $404.00 |
Sizes | 50 µg |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic Peptide within the following region: WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS |
Purity/Format | Lyophilized powder. Add 50 ul of distilled water. Final anti-TMCO4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. |
Description | Polyclonal |
Gene | TMCO4 |
Supplier Page | Shop |