Anti-THYN1 antibody
| Name | Anti-THYN1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82750 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within amino acids 143-192 (NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPL K) of Human THYN1 (NP_054893) |
| Description | Rabbit Polyclonal |
| Gene | THYN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-THYN1 antibody (ab82750) at 1 µg/ml + Fetal muscle lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilutionObserved band size : 26 kDa (why is the actual band size different from the predicted?)