Name | Anti-THYN1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab82750 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within amino acids 143-192 (NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPL K) of Human THYN1 (NP_054893) |
Description | Rabbit Polyclonal |
Gene | THYN1 |
Conjugate | Unconjugated |
Supplier Page | Shop |