C17orf39 Antibody

• Supplier: Genway Biotech
• Catalog: GWB-MT235A
• Prices: $368.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Dog, Horse, Human, Rabbit
• Antigen: Synthetic Peptide within the following region: SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR
• Purity/Format: Lyophilized powder. Add 50 ul of distilled water. Final anti-C17orf39 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
• Description: Rabbit Polyclonal
• Gene: GID4