PRELID2 Antibody

Name PRELID2 Antibody
Supplier Genway Biotech
Catalog GWB-MT073A
Prices $368.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Bovine, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
Antigen Synthetic Peptide within the following region: GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE
Purity/Format Lyophilized powder. Add 50 ul of distilled water. Final anti-PRELID2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
Description Rabbit Polyclonal
Gene PRELID2
Supplier Page Shop