| Name | FAM36A Antibody |
|---|---|
| Supplier | Genway Biotech |
| Catalog | GWB-MT081I |
| Prices | $368.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Horse, Pig, Rabbit |
| Antigen | Synthetic Peptide within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN |
| Purity/Format | Lyophilized powder. Add 50 ul of distilled water. Final anti-FAM36A antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. |
| Description | Rabbit Polyclonal |
| Gene | COX20 |
| Supplier Page | Shop |