Scfd2 Antibody

• Supplier: Genway Biotech
• Catalog: GWB-MS882I
• Prices: $404.00
• Sizes: 50 µg
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Mouse
• Antigen: Synthetic Peptide within the following region: LVSGLSSLCEHLGVREECFAVGPLSRVIATDLANYAPAKNRKKTATGRAS
• Purity/Format: Lyophilized powder. Add 50 ul of distilled water. Final anti-Scfd2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
• Description: Polyclonal
• Gene: Scfd2