Name | Nudt16 Antibody |
---|---|
Supplier | Genway Biotech |
Catalog | GWB-MS848B |
Prices | $368.00 |
Sizes | 50 µg |
Host | Rabbit |
Applications | WB |
Species Reactivities | Bovine, Dog, Guinea Pig, Horse, Human, Pig, Rat |
Antigen | Synthetic Peptide within the following region: VLMQMRFDGRLGFPGGFVDAQDSCLEDGLNRELREELGEAMSAFRVERSD |
Purity/Format | Lyophilized powder. Add 50 ul of distilled water. Final anti-Nudt16 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. |
Description | Rabbit |
Gene | Nudt16 |
Supplier Page | Shop |