PNPLA5 Antibody

• Supplier: Genway Biotech
• Catalog: GWB-MR368H
• Prices: $368.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic Peptide within the following region: NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA
• Purity/Format: Lyophilized powder. Add 50 ul of distilled water. Final anti-PNPLA5 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
• Description: Rabbit Polyclonal
• Gene: PNPLA5