SCAND3 Antibody

Name SCAND3 Antibody
Supplier Genway Biotech
Catalog GWB-MQ901A
Prices $368.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Horse
Antigen Synthetic Peptide within the following region: ETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH
Purity/Format Lyophilized powder. Add 50 ul of distilled water. Final anti-SCAND3 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
Description Rabbit Polyclonal
Gene ZBED9
Supplier Page Shop