SLC22A11 Antibody

• Supplier: Genway Biotech
• Catalog: GWB-MP681F
• Prices: $294.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Bovine, Human
• Antigen: Synthetic Peptide within the following region: MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW
• Purity/Format: Lyophilized powder. Add 100 ul of distilled water. Final anti-SLC22A11 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
• Description: Rabbit Polyclonal
• Gene: SLC22A11