Anti-TLR1 antibody
| Name | Anti-TLR1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab22057 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB FC |
| Species Reactivities | Human |
| Antigen | Synthetic peptide: LQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKV L conjugated to KLH, corresponding to amino acids 400-450 of Human TLR1 |
| Description | Rabbit Polyclonal |
| Gene | TLR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
All lanes : Anti-TLR1 antibody (ab22057) at 2 µg/mlLane 1 : Ramos (Human Burkitt's lymphoma cell line) Whole Cell Lysate (ab3955)Lane 2 : RAW 264.7 (Mouse leukaemic monocyte macrophage cell line) Whole Cell Lysate (ab7187)Observed band size : 87 kDa (why is the actual band size different from the predicted?)Additional bands at : 190 kDa,32 kDa,60 kDa. We are unsure as to the identity of these extra bands.
ab22057, at 4ug/106, staining TLR1 in permeabilised Ramos cells by flow ctometric analysis (open histogram).