Anti-TM2D3 antibody
| Name | Anti-TM2D3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122957 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Cat, Dog, Human, Drosophila, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 171-220 ( TALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGY ) of Mouse TM2D3 (NP_081071; Q8BJ83 isoform 2) |
| Description | Rabbit Polyclonal |
| Gene | TM2D3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TM2D3 antibody (ab122957) at 1 µg/ml + Mouse heart lysate at 10 µg