Anti-TMEM107 antibody
| Name | Anti-TMEM107 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108235 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Horse, Guinea Pig, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 21-64 ( VVITLFWSRDSNIQACLPLTFTPEEYDKQDIHPLPLCRLVAALSVTLGLF ) of Human TMEM107 (NP_115730) |
| Description | Rabbit Polyclonal |
| Gene | TMEM107 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TMEM107 antibody (ab108235) at 1 µg/ml + THP1 Cell Lysate