Name | Anti-TMEM107 antibody |
---|---|
Supplier | Abcam |
Catalog | ab108235 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Horse, Guinea Pig, Cat, Dog |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 21-64 ( VVITLFWSRDSNIQACLPLTFTPEEYDKQDIHPLPLCRLVAALSVTLGLF ) of Human TMEM107 (NP_115730) |
Description | Rabbit Polyclonal |
Gene | TMEM107 |
Conjugate | Unconjugated |
Supplier Page | Shop |