C14ORF131 Antibody

• Supplier: Genway Biotech
• Catalog: GWB-F493BC
• Prices: $268.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic Peptide within the following region: KMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHL
• Purity/Format: Lyophilized powder. Add 100 ul of distilled water. Final anti-C14ORF131 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
• Description: Rabbit Polyclonal
• Gene: ZNF839