Anti-TMEM195 antibody
| Name | Anti-TMEM195 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83030 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 35-84 (VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRL P) of Human TMEM195 (NP_001004320) |
| Description | Rabbit Polyclonal |
| Gene | AGMO |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TMEM195 antibody (ab83030) at 1 µg/ml (5% skim milk / PBS ) + MCF7 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution