Anti-TMEM208 antibody
| Name | Anti-TMEM208 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab130459 |
| Prices | $443.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | Recombinant fragment: PWFTADSGTPAPEHNEKRQRRQERRQMKRL, corresponding to amino acids 144-173 of Human TMEM208 Isoform 1 (Q9BTX3) |
| Description | Rabbit Polyclonal |
| Gene | TMEM208 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunofluorescent staining of Human cell line A-431 shows positivity in cytoplasm. Recommended concentration of ab130459 1-4 µg/ml. Cells treated with PFA/Triton X-100.
![Lane 1: Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10 Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cell.](http://www.bioprodhub.com/system/product_images/ab_products/2/sub_5/12291_ab130459-2-HPA041949.jpg)
Lane 1: Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10 Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cell.
ab130459, at 1/20 dilution, staining TMEM208 in paraffin-embedded Human rectum tissue by Immunohistochemistry