Anti-TMEM69 antibody
| Name | Anti-TMEM69 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab105677 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 131-180 ( AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE ) of Human TMEM69 (NP_057570) |
| Description | Rabbit Polyclonal |
| Gene | TMEM69 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
