Anti-Tmsbl1 antibody

Name Anti-Tmsbl1 antibody
Supplier Abcam
Catalog ab52142
Prices $370.00
Sizes 50 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ELISA
Species Reactivities Human, Mouse, Rat
Antigen Synthetic human Thymosin b15 (aa 1-45) KLH conjugated ( MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS ) Run BLAST with Run BLAST with
Description Rabbit Polyclonal
Gene TMSB15B
Conjugate Unconjugated
Supplier Page Shop