Name | RNF121 Antibody |
---|---|
Supplier | Genway Biotech |
Catalog | GWB-CC2F72 |
Prices | $268.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC |
Species Reactivities | Bovine, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat |
Antigen | Synthetic Peptide within the following region: WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG |
Purity/Format | Lyophilized powder. Add 100 ul of distilled water. Final anti-RNF121 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. |
Description | Rabbit Polyclonal |
Gene | RNF121 |
Supplier Page | Shop |