SALF Antibody

• Supplier: Genway Biotech
• Catalog: GWB-BB9410
• Prices: $294.00
• Sizes: 100 µg
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic Peptide within the following region: NSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRD
• Purity/Format: Lyophilized powder. Add 100 ul of distilled water. Final anti-SALF antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
• Description: Polyclonal
• Gene: STON1-GTF2A1L