Anti-TOM1L2 antibody
| Name | Anti-TOM1L2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab96320 |
| Prices | $376.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IP |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 394-457 ( SLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLR TDLKGDDLEEGVTS ) of Human TOM1L2 |
| Description | Rabbit Polyclonal |
| Gene | TOM1L2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![TOM1L2 was immunoprecipitated using 0.5mg Jurkat whole cell extract, 5µg of Rabbit polyclonal to TOM1L2 and 50µl of protein G magnetic beads (+). No antibody was added to the control (-).The antibody was incubated under agitation with Protein G beads for 10min, Jurkat whole cell extract lysate diluted in RIPA buffer was added to each sample and incubated for a further 10min under agitation.Proteins were eluted by addition of 40µl SDS loading buffer and incubated for 10min at 70°C; 10µl of each sample was separated on a SDS PAGE gel, transferred to a nitrocellulose membrane, blocked with 5% BSA and probed with ab96320.Secondary: Mouse monoclonal [SB62a] Secondary Antibody to Rabbit IgG light chain (HRP) (ab99697)>Band: 56kDa; TOM1L2](http://www.bioprodhub.com/system/product_images/ab_products/2/sub_5/13041_ab96320-209861-IPVI004ab9632020mMod.jpg)
TOM1L2 was immunoprecipitated using 0.5mg Jurkat whole cell extract, 5µg of Rabbit polyclonal to TOM1L2 and 50µl of protein G magnetic beads (+). No antibody was added to the control (-).The antibody was incubated under agitation with Protein G beads for 10min, Jurkat whole cell extract lysate diluted in RIPA buffer was added to each sample and incubated for a further 10min under agitation.Proteins were eluted by addition of 40µl SDS loading buffer and incubated for 10min at 70°C; 10µl of each sample was separated on a SDS PAGE gel, transferred to a nitrocellulose membrane, blocked with 5% BSA and probed with ab96320.Secondary: Mouse monoclonal [SB62a] Secondary Antibody to Rabbit IgG light chain (HRP) (ab99697)>Band: 56kDa; TOM1L2
All lanes : Anti-TOM1L2 antibody (ab96320) at 1/1000 dilutionLane 1 : Jurkat whole cell lysateLane 2 : NT2D1 whole cell lysateLysates/proteins at 30 µg per lane.