| Name | GLTPD2 Antibody |
|---|---|
| Supplier | Genway Biotech |
| Catalog | GWB-9ED1DF |
| Prices | $268.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic Peptide within the following region: LAAMAAWERRAGLLEQPGAAPRDPTRSSGSRTLLLLHRALRWSQLCLHRV |
| Purity/Format | Lyophilized powder. Add 100 ul of distilled water. Final anti-GLTPD2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. |
| Description | Rabbit Polyclonal |
| Gene | GLTPD2 |
| Supplier Page | Shop |