Anti-Transferrin Receptor 2 antibody
| Name | Anti-Transferrin Receptor 2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84287 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 179 - 228 (RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLED P) of Human Transferrin Receptor 2 (NP_003218) |
| Description | Rabbit Polyclonal |
| Gene | TFR2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Transferrin Receptor 2 antibody (ab84287) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal muscle lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
IHC image of ab84287 staining in human normal liver formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with EDTA (pH9, epitope retrieval solution 2) for 20 mins. The section was then incubated with ab84287, 1µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human skin tissue labelling Transferrin Receptor 2 with ab84287 at 4-8µg/ml.