Anti-Transglutaminase 3 antibody
| Name | Anti-Transglutaminase 3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab97954 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Dog |
| Antigen | Synthetic peptide corresponding to N terminal amino acids 1-50 ( MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS ) of Human Transglutaminase 3 (NP_003236) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | TGM3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Transglutaminase 3 antibody (ab97954) at 1 µg/ml + PANC1 cell lysate at 10 µg with skim milk/ PBS buffer at 5 %SecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution