Name | Anti-TSFM antibody |
---|---|
Supplier | Abcam |
Catalog | ab85361 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine |
Antigen | Synthetic peptide corresponding to a region within amino acids 144-193 ( GTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREGSLKDQLALAIGKL ) of Human TSFM (NP_005717) |
Description | Rabbit Polyclonal |
Gene | TSFM |
Conjugate | Unconjugated |
Supplier Page | Shop |