Anti-TSFM antibody
| Name | Anti-TSFM antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85361 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine |
| Antigen | Synthetic peptide corresponding to a region within amino acids 144-193 ( GTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREGSLKDQLALAIGKL ) of Human TSFM (NP_005717) |
| Description | Rabbit Polyclonal |
| Gene | TSFM |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TSFM antibody (ab85361) at 1 µg/ml (in 5% skim milk / PBS buffer) + Hela cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution