Anti-TSPYL6 antibody
| Name | Anti-TSPYL6 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89956 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 108-157 ( DGSLKNGFPGEETHGLGGEKALETCGAGRSESEVIAEGKAEDVKPEECAM ) of Human TSPYL6 (NP_001003937) |
| Description | Rabbit Polyclonal |
| Gene | TSPYL6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TSPYL6 antibody (ab89956) at 1 µg/ml + HT1080 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution