Anti-TULP2 antibody
| Name | Anti-TULP2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86405 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Bovine, Cat |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2 - 51 ( SQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANPD ) of Human TULP2 (NP_003314) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | TULP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
