Anti-TXNDC16 antibody
| Name | Anti-TXNDC16 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81248 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 252-301 (LTEVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGK A) of Human TXNDC16, (NP_065835) |
| Description | Rabbit Polyclonal |
| Gene | TXNDC16 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TXNDC16 antibody (ab81248) at 1 µg/ml + Human fetal brain lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution