Anti-TXNL6 antibody
| Name | Anti-TXNL6 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133774 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 61-110 ( LTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRD ) of Human TXNL6 (NP_612463) |
| Description | Rabbit Polyclonal |
| Gene | NXNL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TXNL6 antibody (ab133774) at 1 µg/ml + ACHN cell lysate at 10 µg