Anti-UEVLD antibody
| Name | Anti-UEVLD antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99133 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 143-192 (SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGG E) of Human UEVLD (NP_060784) |
| Description | Rabbit Polyclonal |
| Gene | UEVLD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-UEVLD antibody (ab99133) at 1 µg/ml + 721_B cell lysate at 10 µg