Anti-USP36 antibody
| Name | Anti-USP36 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab93771 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P |
| Species Reactivities | Human, Mouse, Horse, Dog, Chimpanzee, Monkey, Ape, Orangutan, Bat |
| Antigen | Synthetic peptide corresponding to amino acids 1070 - 1121 of Human USP36 ( WDEEFDRGKEKKIKKFKREKRRNFNAFQKLQTRRNFWSVTHPAKAASLSY RR )(NP_079366 |
| Description | Rabbit Polyclonal |
| Gene | USP36 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
ab93771, at a 1/250 dilution staining USP36 in a formalin fixed parafin embedded section of Human breast carcinoma. Epitope Retrieval was performed using a high pH buffer.