Anti-VWC2L antibody
| Name | Anti-VWC2L antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab126498 |
| Prices | $443.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P |
| Species Reactivities | Human |
| Antigen | antigen sequence AAISHEDYPADEGDQISSNDNLIFDDYRGK, corresponding to amino acids 22-51 of Human VWC2L |
| Description | Rabbit Polyclonal |
| Gene | VWC2L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
ab126498, at 1/50, staining VWC2L in paraffin embedded Human bone marrow by Immunohistochemistry.