Anti-WBP2 antibody
| Name | Anti-WBP2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98184 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 35-85, MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ , of Human WBP2 (NP_036610) |
| Description | Rabbit Polyclonal |
| Gene | WBP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-WBP2 antibody (ab98184) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human Fetal Thymus Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution