Anti-WDR41 antibody
| Name | Anti-WDR41 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab125725 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 200-249 ( LVTPTEELPEWDIIEVKRLLDHQDNILSLANINDTGFVTGSHVGELLIWD ) of Mouse WDR41 (NP_766178) |
| Description | Rabbit Polyclonal |
| Gene | WDR41 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-WDR41 antibody (ab125725) at 1 µg/ml + Mouse small intestine lysate at 10 µg