Anti-WDR45L antibody
| Name | Anti-WDR45L antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab116087 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 65 - 114 ( YLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVV ) of Rat WDR45L (NP_001034676) |
| Description | Rabbit Polyclonal |
| Gene | WDR45B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-WDR45L antibody (ab116087) at 1 µg/ml + Rat liver lysate at 10 µg