Anti-WDR9 antibody
| Name | Anti-WDR9 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94916 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2-51 ( AEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKR ) of Human WDR9 (NP_001007247) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | BRWD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-WDR9 antibody (ab94916) at 1 µg/ml + PANC1 cell lysate at 10 µg with 5% skim milk / PBS bufferGel concentration: 10-20%SecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution