Anti-WFDC10B antibody
| Name | Anti-WFDC10B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab126511 |
| Prices | $443.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P |
| Species Reactivities | Human |
| Antigen | antigen sequence: RDKMRMQRIKVCEKRPSIDLCIHHCSYFQKCETNKICCSAFCGNICMSIL corresponding to amino acids 24-73 of Human WFDC10B |
| Description | Rabbit Polyclonal |
| Gene | WFDC10B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
ab126511, at 1/20 dilution, staining WFDC10B in paraffin-embedded Human stomach by Immunohistochemistry.