Anti-YIF1A antibody

• Supplier: Abcam
• Catalog: ab121455
• Prices: $443.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC-P WB ICC/IF ICC/IF
• Species Reactivities: Mouse, Rat, Human
• Antigen: antigen sequence corresponding to amino acids 240-269 ( ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ ) of Human YIF1A
• Description: Rabbit Polyclonal
• Gene: YIF1A
• Conjugate: Unconjugated

Product images

ab121455, at 1/150 dilution, staining YIF1A in paraffin-embedded Human smooth muscle tissue by Immunohistochemistry.

All lanes : Anti-YIF1A antibody (ab121455) at 1/250 dilutionLane 1 : Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2 : RT-4 cell lysateLane 3 : U-251 MG cell lysateLane 4 : Human Plasma lysateLane 5 : Human Liver lysateLane 6 : Human Tonsil lysate

ab121455, at 4µg/ml, staining YIF1A (green) in A-431 cells by Immunofluorescence.