Anti-ZBTB40 antibody
| Name | Anti-ZBTB40 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86361 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 1116-1165 of Human ZBTB40, PGALQHHVTTEHFKQSETTFPCELCGELFTSQAQLDSHLESEHPKVMSTE , NP_055685 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ZBTB40 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZBTB40 antibody (ab86361) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution