Anti-ZDHHC18 antibody
| Name | Anti-ZDHHC18 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99183 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Drosophila, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 143-192 ( SFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLK ) of Human ZDHHC18 (NP_115659) |
| Description | Rabbit Polyclonal |
| Gene | ZDHHC18 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZDHHC18 antibody (ab99183) at 1 µg/ml + OVCAR3 Cell Lysate at 10 µg