Anti-Zfp275 antibody
| Name | Anti-Zfp275 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab116080 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Human, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 350-399 ( LAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYECNQCGKA ) of Mouse Zfp275 (NP_113682) |
| Description | Rabbit Polyclonal |
| Gene | ZNF275 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Zfp275 antibody (ab116080) at 1 µg/ml + Mouse kidney lysate at 10 µg