Anti-ZFP62 antibody
| Name | Anti-ZFP62 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86680 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 70-120 (TGEKPYECDICGKTFSNSSGLRVHKRIHTGEKPYECDECGKAFITCRTL L) of Human ZFP62 (Q8NB50) |
| Description | Rabbit Polyclonal |
| Gene | ZFP62 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZFP62 antibody (ab86680) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution