Anti-ZIK1 antibody
| Name | Anti-ZIK1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122961 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Human, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 318-367 (KRVHTGERPYKCSECGNSFSQSAILNQHRRIHTGVKPYECRECGKSFSQ K) of Mouse ZIK1 (NP_033603) |
| Description | Rabbit Polyclonal |
| Gene | ZIK1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZIK1 antibody (ab122961) at 1 µg/ml + Mouse kidney lysate at 10 µg